Pay in 4 interest-free payments of $42.82 Learn more
Ships within 48 hours · Estimated delivery Jul 28 - Aug 2
RRID: AB_2845161
Catalogue Numbers: DF9308-100
BS77371-100 Product: 1mg/ml in PBS with 0
Overexpression of Bax accelerates apoptotic death induced by cytokine deprivation in an IL-3 dependent cell line and Bax also counters the death repressor activty of Bcl-2(8)
IHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVIVDHPFFFLIRNRRTGTILFMGRVMHPETMNTSGHDFEEL
PARN Polyclonal Antibody-BS8598 Biopharmaceutical manufacturing RRID: AB_2845161PARN Polyclonal Antibody Product: 1mg ml in PBS with 0. 02% sodium azide, 50% glycerol, pH7. 2 Sizes: 50 l, 100 l Catalogue Numbers: BS8598 50, BS8598 100 Swiss Prot: O95453 Host: Rabbit PARN Polyclonal Antibody BS8598 Storage and Stability: Store at 4C short term. Aliquot and store at 20C long term. Avoid freeze thaw cycles. Reactivity: Human Applications: WB, IF ICC All Applications: WB,1: 500 1: 2000 IF ICC,1: 50 1: 200 Background: The protein